Lineage for d6fzwd1 (6fzw D:8-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777749Family b.23.1.0: automated matches [254288] (1 protein)
    not a true family
  6. 2777750Protein automated matches [254671] (1 species)
    not a true protein
  7. 2777751Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries)
  8. 2777760Domain d6fzwd1: 6fzw D:8-125 [354546]
    automated match to d5cisa3
    complexed with ca, flc

Details for d6fzwd1

PDB Entry: 6fzw (more details), 2.78 Å

PDB Description: crystal structure of the metalloproteinase enhancer pcpe-1 bound to the procollagen c propeptide trimer (long)
PDB Compounds: (D:) Procollagen C-endopeptidase enhancer 1

SCOPe Domain Sequences for d6fzwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fzwd1 b.23.1.0 (D:8-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvflcggdvkgesgyvasegfpnlyppnkeciwtitvpegqtvslsfrvfdlelhpacry
dalevfagsgtsgqrlgrfcgtfrpaplvapgnqvtlrmttdegtggrgfllwysgra

SCOPe Domain Coordinates for d6fzwd1:

Click to download the PDB-style file with coordinates for d6fzwd1.
(The format of our PDB-style files is described here.)

Timeline for d6fzwd1: