Lineage for d6av7b_ (6av7 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56516] (33 PDB entries)
  8. Domain d6av7b_: 6av7 B: [354540]
    automated match to d3e7sa_
    complexed with btb, cl, gd, gol, h4b, hem, w69, zn

Details for d6av7b_

PDB Entry: 6av7 (more details), 1.92 Å

PDB Description: structure of human endothelial nitric oxide synthase heme domain in complex with hw69
PDB Compounds: (B:) Nitric oxide synthase, endothelial

SCOPe Domain Sequences for d6av7b_:

Sequence, based on SEQRES records: (download)

>d6av7b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklqgrpspgppapeqllsq
ardfinqyyssikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvg
riqwgklqvfdardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatas
fmkhleneqkarggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

Sequence, based on observed residues (ATOM records): (download)

>d6av7b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssi
krsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfda
rdcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqd
gsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehp
tlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniled
vavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkar
ggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

SCOPe Domain Coordinates for d6av7b_ are not available.

Timeline for d6av7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6av7a_, d6av7c_, d6av7d_