Lineage for d16pka_ (16pk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141951Protein Phosphoglycerate kinase [53750] (8 species)
  7. 2141979Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [53754] (2 PDB entries)
  8. 2141980Domain d16pka_: 16pk A: [35454]
    complexed with bis, epe

Details for d16pka_

PDB Entry: 16pk (more details), 1.6 Å

PDB Description: phosphoglycerate kinase from trypanosoma brucei bisubstrate analog
PDB Compounds: (A:) 3-phosphoglycerate kinase

SCOPe Domain Sequences for d16pka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk

SCOPe Domain Coordinates for d16pka_:

Click to download the PDB-style file with coordinates for d16pka_.
(The format of our PDB-style files is described here.)

Timeline for d16pka_: