Lineage for d1vpea_ (1vpe A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1388768Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1388769Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1388770Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 1388771Protein Phosphoglycerate kinase [53750] (8 species)
  7. 1388791Species Thermotoga maritima [TaxId:2336] [53753] (1 PDB entry)
  8. 1388792Domain d1vpea_: 1vpe A: [35453]
    complexed with 3pg, anp, mg

Details for d1vpea_

PDB Entry: 1vpe (more details), 2 Å

PDB Description: crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d1vpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]}
ekmtirdvdlkgkrvimrvdfnvpvkdgvvqddtriraalptikyaleqgakvillshlg
rpkgepspefslapvakrlsellgkevkfvpavvgdevkkaveelkegevlllentrfhp
getkndpelakfwasladihvndafgtahrahasnvgiaqfipsvagflmekeikflskv
tynpekpyvvvlggakvsdkigvitnlmekadriliggammftflkalgkevgssrveed
kidlakelvekakekgveivlpvdaviaqkiepgvekkvvriddgipegwmgldigpeti
elfkqklsdaktvvwngpmgvfeiddfaegtkqvalaiaaltekgaitvvgggdsaaavn
kfgledkfshvstgggasleflegkelpgiasmrikka

SCOPe Domain Coordinates for d1vpea_:

Click to download the PDB-style file with coordinates for d1vpea_.
(The format of our PDB-style files is described here.)

Timeline for d1vpea_: