SCOPe 2.01: Domain d1vpea_: 1vpe A:

Lineage for d1vpea_ (1vpe A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has parallel beta-sheet of 6 strands, order 342156
   Domain 2 has parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families)

5. Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
   Domain 2 binds ATP

6. Protein Phosphoglycerate kinase [53750] (8 species)

7. Species Thermotoga maritima [TaxId:2336] [53753] (1 PDB entry)

8. Domain d1vpea_: 1vpe A: [35453]
   complexed with 3pg, anp, mg

Details for d1vpea_

PDB Entry: 1vpe, 2 Å

PDB Description: crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima

PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d1vpea_:

Sequence; same for both SEQRES and ATOM records:

>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]}
ekmtirdvdlkgkrvimrvdfnvpvkdgvvqddtriraalptikyaleqgakvillshlg
rpkgepspefslapvakrlsellgkevkfvpavvgdevkkaveelkegevlllentrfhp
getkndpelakfwasladihvndafgtahrahasnvgiaqfipsvagflmekeikflskv
tynpekpyvvvlggakvsdkigvitnlmekadriliggammftflkalgkevgssrveed
kidlakelvekakekgveivlpvdaviaqkiepgvekkvvriddgipegwmgldigpeti
elfkqklsdaktvvwngpmgvfeiddfaegtkqvalaiaaltekgaitvvgggdsaaavn
kfgledkfshvstgggasleflegkelpgiasmrikka

Timeline for d1vpea_:

• d1vpea_ first appeared (with stable ids) in SCOP 1.55, called d1vpe__
  
• d1vpea_ appears in SCOP 1.75
  
• d1vpea_ appears in SCOPe 2.02
  
• d1vpea_ appears in the current release, SCOPe 2.08