Lineage for d1vpe__ (1vpe -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592656Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 592657Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 592658Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
    Domain 2 binds ATP
  6. 592659Protein Phosphoglycerate kinase [53750] (7 species)
  7. 592675Species Thermotoga maritima [TaxId:243274] [53753] (1 PDB entry)
  8. 592676Domain d1vpe__: 1vpe - [35453]
    complexed with 3pg, anp, mg

Details for d1vpe__

PDB Entry: 1vpe (more details), 2 Å

PDB Description: crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima

SCOP Domain Sequences for d1vpe__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpe__ c.86.1.1 (-) Phosphoglycerate kinase {Thermotoga maritima}
ekmtirdvdlkgkrvimrvdfnvpvkdgvvqddtriraalptikyaleqgakvillshlg
rpkgepspefslapvakrlsellgkevkfvpavvgdevkkaveelkegevlllentrfhp
getkndpelakfwasladihvndafgtahrahasnvgiaqfipsvagflmekeikflskv
tynpekpyvvvlggakvsdkigvitnlmekadriliggammftflkalgkevgssrveed
kidlakelvekakekgveivlpvdaviaqkiepgvekkvvriddgipegwmgldigpeti
elfkqklsdaktvvwngpmgvfeiddfaegtkqvalaiaaltekgaitvvgggdsaaavn
kfgledkfshvstgggasleflegkelpgiasmrikka

SCOP Domain Coordinates for d1vpe__:

Click to download the PDB-style file with coordinates for d1vpe__.
(The format of our PDB-style files is described here.)

Timeline for d1vpe__: