![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
![]() | Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
![]() | Protein automated matches [190558] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries) |
![]() | Domain d6fk0b1: 6fk0 B:10-124 [354526] Other proteins in same PDB: d6fk0a2, d6fk0b2 automated match to d4n6ma_ |
PDB Entry: 6fk0 (more details), 2.9 Å
SCOPe Domain Sequences for d6fk0b1:
Sequence, based on SEQRES records: (download)
>d6fk0b1 d.17.1.0 (B:10-124) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemg stdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm
>d6fk0b1 d.17.1.0 (B:10-124) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemg stdcrktvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm
Timeline for d6fk0b1: