Lineage for d6fsia_ (6fsi A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439628Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2439629Protein automated matches [190158] (30 species)
    not a true protein
  7. 3054461Species Bacillus cereus [TaxId:226900] [354523] (3 PDB entries)
  8. 3054462Domain d6fsia_: 6fsi A: [354524]
    automated match to d3f6ra_
    complexed with fmn, glc, so4

Details for d6fsia_

PDB Entry: 6fsi (more details), 1.32 Å

PDB Description: crystal structure of semiquinone flavodoxin 1 from bacillus cereus (1.32 a resolution)
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d6fsia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fsia_ c.23.5.0 (A:) automated matches {Bacillus cereus [TaxId: 226900]}
sklvmifasmsgnteemadhiagvireteneievidimdspeasileqydgiilgaytwg
dgdlpddfldfydamdsidltgkkaavfgscdsaypkygvavdilieklqergaavvleg
lkveltpededvekclqfgaefvkhls

SCOPe Domain Coordinates for d6fsia_:

Click to download the PDB-style file with coordinates for d6fsia_.
(The format of our PDB-style files is described here.)

Timeline for d6fsia_:

  • d6fsia_ is new in SCOPe 2.07-stable