Lineage for d1php__ (1php -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74864Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
  4. 74865Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 74866Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
  6. 74867Protein Phosphoglycerate kinase [53750] (5 species)
  7. 74868Species Bacillus stearothermophilus [TaxId:1422] [53752] (1 PDB entry)
  8. 74869Domain d1php__: 1php - [35452]

Details for d1php__

PDB Entry: 1php (more details), 1.65 Å

PDB Description: structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms

SCOP Domain Sequences for d1php__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1php__ c.86.1.1 (-) Phosphoglycerate kinase {Bacillus stearothermophilus}
mnkktirdvdvrgkrvfcrvdfnvpmeqgaitddtriraalptiryliehgakvilashl
grpkgkvveelrldavakrlgellerpvaktneavgdevkaavdrlnegdvlllenvrfy
pgeekndpelakafaeladlyvndafgaahrahastegiahylpavagflmekelevlgk
alsnpdrpftaiiggakvkdkigvidnllekvdnliiggglaytfvkalghdvgksllee
dkielaksfmekakekgvrfympvdvvvadrfandantkvvpidaipadwsaldigpktr
elyrdviresklvvwngpmgvfemdafahgtkaiaealaealdtysvigggdsaaavekf
gladkmdhistgggaslefmegkqlpgvvaledk

SCOP Domain Coordinates for d1php__:

Click to download the PDB-style file with coordinates for d1php__.
(The format of our PDB-style files is described here.)

Timeline for d1php__: