Lineage for d6fk0a1 (6fk0 A:10-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935898Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries)
  8. 2935908Domain d6fk0a1: 6fk0 A:10-124 [354515]
    Other proteins in same PDB: d6fk0a2, d6fk0b2
    automated match to d4n6ma_

Details for d6fk0a1

PDB Entry: 6fk0 (more details), 2.9 Å

PDB Description: xray structure of domain-swapped cystatin e dimer
PDB Compounds: (A:) cystatin-M

SCOPe Domain Sequences for d6fk0a1:

Sequence, based on SEQRES records: (download)

>d6fk0a1 d.17.1.0 (A:10-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemg
stdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm

Sequence, based on observed residues (ATOM records): (download)

>d6fk0a1 d.17.1.0 (A:10-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemg
stdcrktgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm

SCOPe Domain Coordinates for d6fk0a1:

Click to download the PDB-style file with coordinates for d6fk0a1.
(The format of our PDB-style files is described here.)

Timeline for d6fk0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fk0a2