Lineage for d6f8sc_ (6f8s C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322951Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2322952Protein automated matches [190907] (17 species)
    not a true protein
  7. 2323072Species Pseudomonas putida [TaxId:303] [354513] (2 PDB entries)
  8. 2323078Domain d6f8sc_: 6f8s C: [354514]
    automated match to d4mcxc_
    complexed with peg, so4

Details for d6f8sc_

PDB Entry: 6f8s (more details), 2.5 Å

PDB Description: toxin-antitoxin complex grata
PDB Compounds: (C:) XRE family transcriptional regulator

SCOPe Domain Sequences for d6f8sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f8sc_ a.35.1.0 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
gmrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicld
ttpefwlnlqtafdlrtaeqqhgdeiigsvqrlva

SCOPe Domain Coordinates for d6f8sc_:

Click to download the PDB-style file with coordinates for d6f8sc_.
(The format of our PDB-style files is described here.)

Timeline for d6f8sc_: