Lineage for d3pgka_ (3pgk A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007123Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1007124Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1007125Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
  6. 1007126Protein Phosphoglycerate kinase [53750] (8 species)
  7. 1007129Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53751] (3 PDB entries)
  8. 1007131Domain d3pgka_: 3pgk A: [35451]
    complexed with 3pg, atp, mg

Details for d3pgka_

PDB Entry: 3pgk (more details), 2.5 Å

PDB Description: the structure of yeast phosphoglycerate kinase at 0.25 nm resolution
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d3pgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgka_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slssklsvqdldlkdkrvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvla
shlgrpngernekyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenl
ryhieeegsrkvdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpq
raagfllekelkyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaft
fkkvlenteigdsifdkavgpeiaklmekakakgvevvlpvdfiiadafsasantktvtd
kegipagwqgldngpesrklfaatvakatvilwngppgvfefekfaagtkalldevvkss
aagntviigggdtatvakkygvtdkishvstgggaslellegkelpgvaflsekk

SCOPe Domain Coordinates for d3pgka_:

Click to download the PDB-style file with coordinates for d3pgka_.
(The format of our PDB-style files is described here.)

Timeline for d3pgka_: