Lineage for d3pgk__ (3pgk -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321250Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 321251Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 321252Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
    Domain 2 binds ATP
  6. 321253Protein Phosphoglycerate kinase [53750] (6 species)
  7. 321256Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53751] (3 PDB entries)
  8. 321258Domain d3pgk__: 3pgk - [35451]
    complexed with atp, mg, mp3

Details for d3pgk__

PDB Entry: 3pgk (more details), 2.5 Å

PDB Description: the structure of yeast phosphoglycerate kinase at 0.25 nm resolution

SCOP Domain Sequences for d3pgk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgk__ c.86.1.1 (-) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae)}
slssklsvqdldlkdkrvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvla
shlgrpngernekyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenl
ryhieeegsrkvdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpq
raagfllekelkyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaft
fkkvlenteigdsifdkavgpeiaklmekakakgvevvlpvdfiiadafsasantktvtd
kegipagwqgldngpesrklfaatvakatvilwngppgvfefekfaagtkalldevvkss
aagntviigggdtatvakkygvtdkishvstgggaslellegkelpgvaflsekk

SCOP Domain Coordinates for d3pgk__:

Click to download the PDB-style file with coordinates for d3pgk__.
(The format of our PDB-style files is described here.)

Timeline for d3pgk__: