Lineage for d6dweg_ (6dwe G:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414536Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2414537Protein automated matches [190292] (37 species)
    not a true protein
  7. 2414665Species Mycobacterium tuberculosis [TaxId:83332] [334895] (8 PDB entries)
  8. 3054433Domain d6dweg_: 6dwe G: [354495]
    automated match to d5tcja_
    complexed with act, cs, edo, fmt, hdj, mla, mli, p1t, pge

Details for d6dweg_

PDB Entry: 6dwe (more details), 2.69 Å

PDB Description: crystal structure of tryptophan synthase from m. tuberculosis - aminoacrylate- and brd0059-bound form
PDB Compounds: (G:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d6dweg_:

Sequence, based on SEQRES records: (download)

>d6dweg_ c.1.2.0 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaastmgv
tgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalte
glprlraltgelaagvrlg

Sequence, based on observed residues (ATOM records): (download)

>d6dweg_ c.1.2.0 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqaa
pelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltge
laagvrlg

SCOPe Domain Coordinates for d6dweg_:

Click to download the PDB-style file with coordinates for d6dweg_.
(The format of our PDB-style files is described here.)

Timeline for d6dweg_:

  • d6dweg_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-12