Lineage for d6cfob2 (6cfo B:186-329)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458950Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2458951Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2459003Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. 2459041Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)
  7. 2459042Species Human (Homo sapiens) [TaxId:9606] [89713] (9 PDB entries)
  8. 3054431Domain d6cfob2: 6cfo B:186-329 [354493]
    Other proteins in same PDB: d6cfob1, d6cfob3, d6cfod1, d6cfod3
    automated match to d3exeb2
    complexed with a5x, mg

Details for d6cfob2

PDB Entry: 6cfo (more details), 2.7 Å

PDB Description: human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d6cfob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfob2 c.48.1.2 (B:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd
metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya
kilednsipqvkdiifaikktlni

SCOPe Domain Coordinates for d6cfob2:

Click to download the PDB-style file with coordinates for d6cfob2.
(The format of our PDB-style files is described here.)

Timeline for d6cfob2: