SCOPe 2.07: Domain d6cfob1: 6cfo B:1-185

Lineage for d6cfob1 (6cfo B:1-185)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)

8. Domain d6cfob1: 6cfo B:1-185 [354491]
   Other proteins in same PDB: d6cfob2, d6cfob3, d6cfod2, d6cfod3
   automated match to d3exeb1
   complexed with a5x, mg

Details for d6cfob1

PDB Entry: 6cfo, 2.7 Å

PDB Description: human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d6cfob1:

Sequence; same for both SEQRES and ATOM records:

>d6cfob1 c.36.1.0 (B:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

Timeline for d6cfob1:

• d6cfob1 is new in SCOPe 2.07-stable
  
• d6cfob1 appears in the current release, SCOPe 2.08