Lineage for d6cfod1 (6cfo D:1-185)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445862Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2445863Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2446486Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2446487Protein automated matches [227126] (21 species)
    not a true protein
  7. 2446579Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)
  8. 3054427Domain d6cfod1: 6cfo D:1-185 [354489]
    Other proteins in same PDB: d6cfob2, d6cfob3, d6cfod2, d6cfod3
    automated match to d3exeb1
    complexed with a5x, mg

Details for d6cfod1

PDB Entry: 6cfo (more details), 2.7 Å

PDB Description: human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate
PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d6cfod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfod1 c.36.1.0 (D:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

SCOPe Domain Coordinates for d6cfod1:

Click to download the PDB-style file with coordinates for d6cfod1.
(The format of our PDB-style files is described here.)

Timeline for d6cfod1: