SCOPe 2.07: Domain d6cdba_: 6cdb A:

Lineage for d6cdba_ (6cdb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [191027] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)

8. Domain d6cdba_: 6cdb A: [354480]
   automated match to d1r1uc_
   complexed with cl, na, pg4, zn

Details for d6cdba_

PDB Entry: 6cdb, 1.99 Å

PDB Description: crystal structure of v66l czra in the zn(ii)bound state

PDB Compounds: (A:) ArsR family transcriptional regulator

SCOPe Domain Sequences for d6cdba_:

Sequence; same for both SEQRES and ATOM records:

>d6cdba_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
seintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllks
lhlvkakrqgqsmiyslddihvatmlkqaihhanhpk

Timeline for d6cdba_:

• d6cdba_ is new in SCOPe 2.07-stable
  
• d6cdba_ appears in the current release, SCOPe 2.08