Lineage for d6cdba_ (6cdb A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. Protein automated matches [191027] (2 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)
  8. Domain d6cdba_: 6cdb A: [354480]
    automated match to d1r1uc_
    complexed with cl, na, pg4, zn

Details for d6cdba_

PDB Entry: 6cdb (more details), 1.99 Å

PDB Description: crystal structure of v66l czra in the zn(ii)bound state
PDB Compounds: (A:) ArsR family transcriptional regulator

SCOPe Domain Sequences for d6cdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cdba_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
seintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllks
lhlvkakrqgqsmiyslddihvatmlkqaihhanhpk

SCOPe Domain Coordinates for d6cdba_ are not available.

Timeline for d6cdba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6cdbb_