Lineage for d6av7a_ (6av7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2609059Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2609254Species Human (Homo sapiens) [TaxId:9606] [56516] (33 PDB entries)
  8. 2609275Domain d6av7a_: 6av7 A: [354475]
    automated match to d3e7sa_
    complexed with btb, cl, gd, gol, h4b, hem, w69, zn

Details for d6av7a_

PDB Entry: 6av7 (more details), 1.92 Å

PDB Description: structure of human endothelial nitric oxide synthase heme domain in complex with hw69
PDB Compounds: (A:) Nitric oxide synthase, endothelial

SCOPe Domain Sequences for d6av7a_:

Sequence, based on SEQRES records: (download)

>d6av7a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
fprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklqgrpspgppapeqllsqa
rdfinqyyssikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgr
iqwgklqvfdardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsq
lvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllpp
elvlevplehptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnl
cdphryniledvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasf
mkhleneqkarggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

Sequence, based on observed residues (ATOM records): (download)

>d6av7a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
fprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklapeqllsqardfinqyys
sikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvf
dardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrq
qdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevple
hptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphrynil
edvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqk
arggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

SCOPe Domain Coordinates for d6av7a_:

Click to download the PDB-style file with coordinates for d6av7a_.
(The format of our PDB-style files is described here.)

Timeline for d6av7a_: