SCOPe 2.07: Domain d6atdb2: 6atd B:111-218

Lineage for d6atdb2 (6atd B:111-218)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)

8. Domain d6atdb2: 6atd B:111-218 [354472]
   Other proteins in same PDB: d6atda3, d6atdb3
   automated match to d2shpa3
   complexed with po4

Details for d6atdb2

PDB Entry: 6atd, 2.5 Å

PDB Description: oxidized shp2 forms a disulfide bond between cys367 and cys459

PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6atdb2:

Sequence, based on SEQRES records:

>d6atdb2 d.93.1.0 (B:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records):

>d6atdb2 d.93.1.0 (B:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdgkskvthvmircqel
kydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Timeline for d6atdb2:

• d6atdb2 is new in SCOPe 2.07-stable
  
• d6atdb2 appears in the current release, SCOPe 2.08