SCOPe 2.08: Domain d6dpue2: 6dpu E:246-439

Lineage for d6dpue2 (6dpu E:246-439)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

8. Domain d6dpue2: 6dpu E:246-439 [354463]
   Other proteins in same PDB: d6dpua1, d6dpub1, d6dpuc1, d6dpud1, d6dpue1, d6dpuf1, d6dpug1, d6dpuh1, d6dpui1, d6dpuj1, d6dpuk1, d6dpul1
   automated match to d4i50a2
   complexed with g2p, gtp, mg

Details for d6dpue2

PDB Entry: 6dpu, 3.1 Å

PDB Description: undecorated gmpcpp microtubule

PDB Compounds: (E:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6dpue2:

Sequence; same for both SEQRES and ATOM records:

>d6dpue2 d.79.2.1 (E:246-439) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

Timeline for d6dpue2:

• d6dpue2 first appeared in SCOPe 2.07