SCOPe 2.07: Domain d6dpuh2: 6dpu H:246-437

Lineage for d6dpuh2 (6dpu H:246-437)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)

Domain d6dpuh2: 6dpu H:246-437 [354461]
Other proteins in same PDB: d6dpua1, d6dpub1, d6dpuc1, d6dpud1, d6dpue1, d6dpuf1, d6dpug1, d6dpuh1, d6dpui1, d6dpuj1, d6dpuk1, d6dpul1
automated match to d3rycd2
complexed with g2p, gtp, mg

Details for d6dpuh2

PDB Entry: 6dpu (more details), 3.1 Å

PDB Description: undecorated gmpcpp microtubule

PDB Compounds: (H:) Tubulin beta chain

SCOPe Domain Sequences for d6dpuh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dpuh2 d.79.2.1 (H:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

SCOPe Domain Coordinates for d6dpuh2:

Click to download the PDB-style file with coordinates for d6dpuh2.
(The format of our PDB-style files is described here.)

Timeline for d6dpuh2: