Lineage for d6dpuk2 (6dpu K:246-439)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525709Species Pig (Sus scrofa) [TaxId:9823] [278816] (24 PDB entries)
  8. 3054395Domain d6dpuk2: 6dpu K:246-439 [354457]
    Other proteins in same PDB: d6dpua1, d6dpub1, d6dpuc1, d6dpud1, d6dpue1, d6dpuf1, d6dpug1, d6dpuh1, d6dpui1, d6dpuj1, d6dpuk1, d6dpul1
    automated match to d4i50a2
    complexed with g2p, gtp, mg

Details for d6dpuk2

PDB Entry: 6dpu (more details), 3.1 Å

PDB Description: undecorated gmpcpp microtubule
PDB Compounds: (K:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6dpuk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dpuk2 d.79.2.1 (K:246-439) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d6dpuk2:

Click to download the PDB-style file with coordinates for d6dpuk2.
(The format of our PDB-style files is described here.)

Timeline for d6dpuk2:

  • d6dpuk2 appears in periodic updates to SCOPe 2.07 starting on 2018-07-05