Lineage for d5yptc2 (5ypt C:238-393)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. Protein automated matches [196909] (82 species)
    not a true protein
  7. Species Marchantia polymorpha [TaxId:3197] [354367] (1 PDB entry)
  8. Domain d5yptc2: 5ypt C:238-393 [354452]
    automated match to d3wd8a2

Details for d5yptc2

PDB Entry: 5ypt (more details), 2.3899999999999997 Å

PDB Description: crystal structure of marchantia paleacea chalone synthase like 1 (chsl1)
PDB Compounds: (C:) Stilbenecarboxylate synthase 1

SCOPe Domain Sequences for d5yptc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yptc2 c.95.1.0 (C:238-393) automated matches {Marchantia polymorpha [TaxId: 3197]}
qfeihwsgetilpesdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspsw
ndlfwcvhpggraildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsae
kksrttgegcewglvvgfgpgltvevsvlraiatgh

SCOPe Domain Coordinates for d5yptc2 are not available.

Timeline for d5yptc2:

Domains from same chain:
(mouse over for more information)
d5yptc1
Domains from other chains:
(mouse over for more information)
d5ypta1, d5ypta2, d5yptb1, d5yptb2, d5yptd1, d5yptd2, d5ypte1, d5ypte2, d5yptf1, d5yptf2