SCOPe 2.07: Domain d6duxb1: 6dux B:2-167

Lineage for d6duxb1 (6dux B:2-167)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries)

8. Domain d6duxb1: 6dux B:2-167 [354429]
   Other proteins in same PDB: d6duxa2, d6duxa3, d6duxb2, d6duxb3
   automated match to d1u8xx1
   complexed with act, bct, cl, gol, lmr, nad

Details for d6duxb1

PDB Entry: 6dux, 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with nad.

PDB Compounds: (B:) 6-phospho-alpha-glucosidase

SCOPe Domain Sequences for d6duxb1:

Sequence; same for both SEQRES and ATOM records:

>d6duxb1 c.2.1.0 (B:2-167) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilkeqap
eiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggiaygmr
siggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakiln

Timeline for d6duxb1:

• d6duxb1 is new in SCOPe 2.07-stable
  
• d6duxb1 appears in the current release, SCOPe 2.08