Lineage for d5xx5a_ (5xx5 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032711Protein automated matches [190046] (3 species)
    not a true protein
  7. 3032712Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)
  8. 3032743Domain d5xx5a_: 5xx5 A: [354424]
    automated match to d2zvxa_
    complexed with so4; mutant

Details for d5xx5a_

PDB Entry: 5xx5 (more details), 1.38 Å

PDB Description: a bpti-[5,55] variant with c14ga38i mutations
PDB Compounds: (A:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d5xx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xx5a_ g.8.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpgkariiryfynakaglaqtfvyggirakrnnfksaedalrtcgga

SCOPe Domain Coordinates for d5xx5a_:

Click to download the PDB-style file with coordinates for d5xx5a_.
(The format of our PDB-style files is described here.)

Timeline for d5xx5a_: