Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Colwellia psychrerythraea [TaxId:167879] [354415] (1 PDB entry) |
Domain d5xv9a_: 5xv9 A: [354416] automated match to d3cama_ |
PDB Entry: 5xv9 (more details)
SCOPe Domain Sequences for d5xv9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xv9a_ b.40.4.0 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]} mskgivkwfnsdkgfgfitpedgskdlfvhhseiqsggeyatladgqtveyevgqgqkgp cankvvav
Timeline for d5xv9a_: