Lineage for d5xv9a_ (5xv9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400055Species Colwellia psychrerythraea [TaxId:167879] [354415] (1 PDB entry)
  8. 2400056Domain d5xv9a_: 5xv9 A: [354416]
    automated match to d3cama_

Details for d5xv9a_

PDB Entry: 5xv9 (more details)

PDB Description: solution structure of cold shock protein from colwellia psychrerythraea
PDB Compounds: (A:) Cold-shock DNA-binding domain family protein

SCOPe Domain Sequences for d5xv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xv9a_ b.40.4.0 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
mskgivkwfnsdkgfgfitpedgskdlfvhhseiqsggeyatladgqtveyevgqgqkgp
cankvvav

SCOPe Domain Coordinates for d5xv9a_:

Click to download the PDB-style file with coordinates for d5xv9a_.
(The format of our PDB-style files is described here.)

Timeline for d5xv9a_: