Lineage for d6duxa1 (6dux A:2-167)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. Protein automated matches [190069] (313 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries)
  8. Domain d6duxa1: 6dux A:2-167 [354409]
    Other proteins in same PDB: d6duxa2, d6duxa3, d6duxb2, d6duxb3
    automated match to d1u8xx1
    complexed with act, bct, cl, gol, lmr, nad

Details for d6duxa1

PDB Entry: 6dux (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with nad.
PDB Compounds: (A:) 6-phospho-alpha-glucosidase

SCOPe Domain Sequences for d6duxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6duxa1 c.2.1.0 (A:2-167) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilkeqap
eiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggiaygmr
siggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakiln

SCOPe Domain Coordinates for d6duxa1 are not available.

Timeline for d6duxa1:

Domains from same chain:
(mouse over for more information)
d6duxa2, d6duxa3
Domains from other chains:
(mouse over for more information)
d6duxb1, d6duxb2, d6duxb3