Lineage for d5yzia_ (5yzi A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. Protein automated matches [190072] (22 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [187557] (3 PDB entries)
  8. Domain d5yzia_: 5yzi A: [354407]
    automated match to d1t0la_
    complexed with cd, nap

Details for d5yzia_

PDB Entry: 5yzi (more details), 2.52 Å

PDB Description: crystal structure of mouse cytosolic isocitrate dehydrogenase complexed with cadmium
PDB Compounds: (A:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d5yzia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yzia_ c.77.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqk
icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqa

SCOPe Domain Coordinates for d5yzia_ are not available.

Timeline for d5yzia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5yzib_