Lineage for d5xuxe_ (5xux E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904219Species Methanosarcina mazei [TaxId:192952] [354310] (4 PDB entries)
  8. 2904231Domain d5xuxe_: 5xux E: [354406]
    Other proteins in same PDB: d5xuxa2, d5xuxf2
    automated match to d2azna1
    complexed with nap

Details for d5xuxe_

PDB Entry: 5xux (more details), 2.27 Å

PDB Description: crystal structure of rib7 from methanosarcina mazei
PDB Compounds: (E:) conserved protein

SCOPe Domain Sequences for d5xuxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xuxe_ c.71.1.0 (E:) automated matches {Methanosarcina mazei [TaxId: 192952]}
drpfifinsamsadgklstkerkqvkisgkldfermdelrahadaimvgigtvladdpsl
tvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekirm
leekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgnl
iiggktaptftdgegftenellglelssaekiedgillkwkvk

SCOPe Domain Coordinates for d5xuxe_:

Click to download the PDB-style file with coordinates for d5xuxe_.
(The format of our PDB-style files is described here.)

Timeline for d5xuxe_: