Lineage for d5ysma_ (5ysm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2723142Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2723143Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2724019Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2724020Protein automated matches [190847] (97 species)
    not a true protein
  7. 2724046Species Amycolatopsis mediterranei [TaxId:749927] [354377] (2 PDB entries)
  8. 2724047Domain d5ysma_: 5ysm A: [354390]
    automated match to d4fxba_
    complexed with hem

Details for d5ysma_

PDB Entry: 5ysm (more details), 1.9 Å

PDB Description: crystal structure analysis of rif16
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5ysma_:

Sequence, based on SEQRES records: (download)

>d5ysma_ a.104.1.0 (A:) automated matches {Amycolatopsis mediterranei [TaxId: 749927]}
lppefvrredpfhvppalvavsergpvaratlaagdpfwlvsgyeearavlsdprfssdr
fqyhpwfkelspefrerlrddkaragsfinmdppehtryrklltgqftvrrirelgarid
eivagrvdamlaggttadlmtefafpapslmicellgvryedraefqqrasallqmnapv
aeavknadalrafmqalvtdkranpagdiisglihhagadpaltddelinianllliagy
dttasmlglgifvllqrpaqlatlrddpsriadaveellrylsvvnpgifrfakedlefa
gehipagstvvvsvvatnrdarhwpdpdldltrprgphlafghgvhqclgqqlarmemqa
gyaellrrlpnvrlavppeevplrndmltygvhslpiawd

Sequence, based on observed residues (ATOM records): (download)

>d5ysma_ a.104.1.0 (A:) automated matches {Amycolatopsis mediterranei [TaxId: 749927]}
lppefvrredpfhvppalvavsergpvaratldpfwlvsgyeearavlsdprfssdrfqy
ragsfinmdppehtryrklltgqftvrrirelgarideivagrvdamlaggttadlmtef
afpapslmicellgvryedraefqqrasaladalrafmqalvtdkranpagdiisglihh
agadpaltddelinianllliagydttasmlglgifvllqrpaqlatlrddpsriadave
ellrylsvvnpgifrfakedlefagehipagstvvvsvvatnrdarhwpdpdldltrprg
phlafghgvhqclgqqlarmemqagyaellrrlpnvrlavppeevplrndmltygvhslp
iawd

SCOPe Domain Coordinates for d5ysma_:

Click to download the PDB-style file with coordinates for d5ysma_.
(The format of our PDB-style files is described here.)

Timeline for d5ysma_: