Lineage for d5odbb2 (5odb B:109-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (30 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. 2754573Domain d5odbb2: 5odb B:109-209 [354388]
    Other proteins in same PDB: d5odba_, d5odbb1
    automated match to d1lila2
    complexed with gol, so4

Details for d5odbb2

PDB Entry: 5odb (more details), 1.53 Å

PDB Description: crystal structure of the ra-associated mab d10 (chimeric fab fragment)
PDB Compounds: (B:) D10 Fab fragment - light chain

SCOPe Domain Sequences for d5odbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5odbb2 b.1.1.0 (B:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsr

SCOPe Domain Coordinates for d5odbb2:

Click to download the PDB-style file with coordinates for d5odbb2.
(The format of our PDB-style files is described here.)

Timeline for d5odbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5odbb1
View in 3D
Domains from other chains:
(mouse over for more information)
d5odba_