Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily) 3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5 |
Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) |
Family c.74.1.0: automated matches [227217] (1 protein) not a true family |
Protein automated matches [226955] (4 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [354229] (2 PDB entries) |
Domain d6btda_: 6btd A: [354382] automated match to d2fuaa_ complexed with mn, so4 |
PDB Entry: 6btd (more details), 1.55 Å
SCOPe Domain Sequences for d6btda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6btda_ c.74.1.0 (A:) automated matches {Bacillus thuringiensis [TaxId: 1428]} mllqkereeivaygkkmissgltkgtggnisifnreqglvaispsgleyyetkpedvvil nldgeviegerkpsseldmhliyyrkredinalvhthspyaktiaslgwelpavsyliaf agpnvrcapyetfgtkqladaafegmidrravllanhgliagannikmaftvaeeiefca qiyyqtksigepkllpedemenl
Timeline for d6btda_: