Lineage for d6btda_ (6btd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905490Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2905491Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2905593Family c.74.1.0: automated matches [227217] (1 protein)
    not a true family
  6. 2905594Protein automated matches [226955] (4 species)
    not a true protein
  7. 2905598Species Bacillus thuringiensis [TaxId:1428] [354229] (2 PDB entries)
  8. 2905599Domain d6btda_: 6btd A: [354382]
    automated match to d2fuaa_
    complexed with mn, so4

Details for d6btda_

PDB Entry: 6btd (more details), 1.55 Å

PDB Description: crystal structure of deoxyribose-phosphate aldolase from bacillus thuringiensis involved in dispatching the ubiquitous radical sam enzyme byproduct 5-deoxyribose
PDB Compounds: (A:) Fuculose phosphate aldolase

SCOPe Domain Sequences for d6btda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6btda_ c.74.1.0 (A:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
mllqkereeivaygkkmissgltkgtggnisifnreqglvaispsgleyyetkpedvvil
nldgeviegerkpsseldmhliyyrkredinalvhthspyaktiaslgwelpavsyliaf
agpnvrcapyetfgtkqladaafegmidrravllanhgliagannikmaftvaeeiefca
qiyyqtksigepkllpedemenl

SCOPe Domain Coordinates for d6btda_:

Click to download the PDB-style file with coordinates for d6btda_.
(The format of our PDB-style files is described here.)

Timeline for d6btda_: