Lineage for d5xx4b_ (5xx4 B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637462Protein automated matches [190046] (3 species)
    not a true protein
  7. 2637463Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)
  8. 2637506Domain d5xx4b_: 5xx4 B: [354381]
    automated match to d2zjxa_
    complexed with so4; mutant

Details for d5xx4b_

PDB Entry: 5xx4 (more details), 1.67 Å

PDB Description: a bpti-[5,55] variant with c14ga38k mutations
PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d5xx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xx4b_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpgkariiryfynakaglaqtfvyggkrakrnnfksaedalrtcgga

SCOPe Domain Coordinates for d5xx4b_:

Click to download the PDB-style file with coordinates for d5xx4b_.
(The format of our PDB-style files is described here.)

Timeline for d5xx4b_: