Lineage for d5yswa_ (5ysw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336229Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2336230Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2337106Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2337107Protein automated matches [190847] (95 species)
    not a true protein
  7. 2337133Species Amycolatopsis mediterranei [TaxId:749927] [354377] (2 PDB entries)
  8. 2337135Domain d5yswa_: 5ysw A: [354378]
    automated match to d4fxba_
    complexed with 9lf, hem

Details for d5yswa_

PDB Entry: 5ysw (more details), 2.6 Å

PDB Description: crystal structure analysis of rif16 in complex with r-l
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5yswa_:

Sequence, based on SEQRES records: (download)

>d5yswa_ a.104.1.0 (A:) automated matches {Amycolatopsis mediterranei [TaxId: 749927]}
ppefvrredpfhvppalvavsergpvaratlaagdpfwlvsgyeearavlsdprfssdrf
qyhpwfkelspefrerlrddkaragsfinmdppehtryrklltgqftvrrirelgaride
ivagrvdamlaggttadlmtefafpapslmicellgvryedraefqqrasallqmnapva
eavknadalrafmqalvtdkranpagdiisglihhagadpaltddelinianllliagyd
ttasmlglgifvllqrpaqlatlrddpsriadaveellrylsvvnpgifrfakedlefag
ehipagstvvvsvvatnrdarhwpdpdldltrprgphlafghgvhqclgqqlarmemqag
yaellrrlpnvrlavppeevplrndmltygvhslpiawd

Sequence, based on observed residues (ATOM records): (download)

>d5yswa_ a.104.1.0 (A:) automated matches {Amycolatopsis mediterranei [TaxId: 749927]}
ppefvrredpfhvppalvavsergpvaratladpfwlvsgyeearavlsdprfssdrfqy
ragsfinmdppehtryrklltgqftvrrirelgarideivagrvdamlaggttadlmtef
afpapslmicellgvryedraefqqrasallqmnapvaeaadalrafmqalvtdkranpa
gdiisglihhagadpaltddelinianllliagydttasmlglgifvllqrpaqlatlrd
dpsriadaveellrylsvvnpgifrfakedlefagehipagstvvvsvvatnrdarhwpd
pdldltrprgphlafghgvhqclgqqlarmemqagyaellrrlpnvrlavppeevplrnd
mltygvhslpiawd

SCOPe Domain Coordinates for d5yswa_:

Click to download the PDB-style file with coordinates for d5yswa_.
(The format of our PDB-style files is described here.)

Timeline for d5yswa_: