![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
![]() | Protein Phosphoglucomutase [53740] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
![]() | Domain d1lxtb3: 1lxt B:304-420 [35437] Other proteins in same PDB: d1lxta4, d1lxtb4 |
PDB Entry: 1lxt (more details), 2.7 Å
SCOP Domain Sequences for d1lxtb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxtb3 c.84.1.1 (B:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
Timeline for d1lxtb3:
![]() Domains from other chains: (mouse over for more information) d1lxta1, d1lxta2, d1lxta3, d1lxta4 |