SCOPe 2.07: Domain d5xx3a_: 5xx3 A:

Lineage for d5xx3a_ (5xx3 A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)

8. Domain d5xx3a_: 5xx3 A: [354368]
   automated match to d2zjxa_
   complexed with so4; mutant

Details for d5xx3a_

PDB Entry: 5xx3, 1.12 Å

PDB Description: a bpti-[5,55] variant with c14ga38g mutations

PDB Compounds: (A:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d5xx3a_:

Sequence; same for both SEQRES and ATOM records:

>d5xx3a_ g.8.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpgkariiryfynakaglaqtfvygggrakrnnfksaedalrtcgga

Timeline for d5xx3a_:

• d5xx3a_ is new in SCOPe 2.07-stable
  
• d5xx3a_ appears in the current release, SCOPe 2.08