| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (27 species) not a true protein |
| Species Methanosarcina mazei [TaxId:192952] [354310] (4 PDB entries) |
| Domain d5xv5e_: 5xv5 E: [354366] Other proteins in same PDB: d5xv5a2, d5xv5d2 automated match to d2azna1 mutant |
PDB Entry: 5xv5 (more details), 2.5 Å
SCOPe Domain Sequences for d5xv5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xv5e_ c.71.1.0 (E:) automated matches {Methanosarcina mazei [TaxId: 192952]}
rpfifinsamsadgklstkerkqvkisgkldfermdelrahadaimvgigtvladdpslt
vksperkaarkaagksenpvrvvvdesartplnadifkkgeglriiavsnsapeekirml
eekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgnli
iggktaptftdgegftenellglelssaekiedgillkwkvk
Timeline for d5xv5e_: