Lineage for d5xv5e_ (5xv5 E:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. Protein automated matches [190777] (27 species)
    not a true protein
  7. Species Methanosarcina mazei [TaxId:192952] [354310] (4 PDB entries)
  8. Domain d5xv5e_: 5xv5 E: [354366]
    Other proteins in same PDB: d5xv5a2, d5xv5d2
    automated match to d2azna1
    mutant

Details for d5xv5e_

PDB Entry: 5xv5 (more details), 2.5 Å

PDB Description: crystal structure of rib7 mutant s88e from methanosarcina mazei
PDB Compounds: (E:) conserved protein

SCOPe Domain Sequences for d5xv5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xv5e_ c.71.1.0 (E:) automated matches {Methanosarcina mazei [TaxId: 192952]}
rpfifinsamsadgklstkerkqvkisgkldfermdelrahadaimvgigtvladdpslt
vksperkaarkaagksenpvrvvvdesartplnadifkkgeglriiavsnsapeekirml
eekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgnli
iggktaptftdgegftenellglelssaekiedgillkwkvk

SCOPe Domain Coordinates for d5xv5e_ are not available.

Timeline for d5xv5e_:

Domains from other chains:
(mouse over for more information)
d5xv5a1, d5xv5a2, d5xv5b_, d5xv5c_, d5xv5d1, d5xv5d2, d5xv5f_