Lineage for d1lxtb2 (1lxt B:191-303)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127595Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
  4. 127596Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 127597Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 127612Protein Phosphoglucomutase [53740] (1 species)
  7. 127613Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 127642Domain d1lxtb2: 1lxt B:191-303 [35436]
    Other proteins in same PDB: d1lxta4, d1lxtb4

Details for d1lxtb2

PDB Entry: 1lxt (more details), 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit

SCOP Domain Sequences for d1lxtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxtb2 c.84.1.1 (B:191-303) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOP Domain Coordinates for d1lxtb2:

Click to download the PDB-style file with coordinates for d1lxtb2.
(The format of our PDB-style files is described here.)

Timeline for d1lxtb2: