| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) ![]() |
| Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (1 protein) |
| Protein Phosphoglucomutase, first 3 domains [53740] (1 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
| Domain d1lxtb2: 1lxt B:191-303 [35436] Other proteins in same PDB: d1lxta4, d1lxtb4 |
PDB Entry: 1lxt (more details), 2.7 Å
SCOP Domain Sequences for d1lxtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxtb2 c.84.1.1 (B:191-303) Phosphoglucomutase, first 3 domains {Rabbit (Oryctolagus cuniculus)}
veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv
Timeline for d1lxtb2:
View in 3DDomains from other chains: (mouse over for more information) d1lxta1, d1lxta2, d1lxta3, d1lxta4 |