SCOPe 2.08: Domain d5yeqa2: 5yeq A:184-330

Lineage for d5yeqa2 (5yeq A:184-330)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Sulfolobus acidocaldarius [TaxId:2285] [354357] (1 PDB entry)

8. Domain d5yeqa2: 5yeq A:184-330 [354358]
   Other proteins in same PDB: d5yeqa1, d5yeqb1
   automated match to d4xdza2
   complexed with edo, mg, so4

Details for d5yeqa2

PDB Entry: 5yeq, 1.75 Å

PDB Description: the structure of sac-kari protein

PDB Compounds: (A:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d5yeqa2:

Sequence; same for both SEQRES and ATOM records:

>d5yeqa2 a.100.1.0 (A:184-330) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
fkeetetdlfgeqvdlvggvmqlmryafqtlveagyqpevayfetinemklivdlvyekg
fsgmltavsdtakyggmtvgkmvidesvkermkkaldnirsgkfaekwveeygkgantik
egmkevdnsteekvgrslrdiilrgkp

Timeline for d5yeqa2:

• d5yeqa2 first appeared in SCOPe 2.07