Lineage for d5nwed_ (5nwe D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (20 species)
    not a true protein
  7. 2398698Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. 3054287Domain d5nwed_: 5nwe D: [354349]
    automated match to d5huga_
    complexed with bma, ca, fuc, g39, man, nag; mutant

Details for d5nwed_

PDB Entry: 5nwe (more details), 2 Å

PDB Description: complex of h275y mutant variant of neuraminidase from h1n1 influenza virus with oseltamivir
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d5nwed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nwed_ b.68.1.0 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg
kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
sisfcgvnsdtvgwswpdgaelpftidk

SCOPe Domain Coordinates for d5nwed_:

Click to download the PDB-style file with coordinates for d5nwed_.
(The format of our PDB-style files is described here.)

Timeline for d5nwed_:

  • d5nwed_ is new in SCOPe 2.07-stable