Lineage for d5omua_ (5omu A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. Protein automated matches [190847] (97 species)
    not a true protein
  7. Species Amycolatopsis sp. [TaxId:385957] [354294] (24 PDB entries)
  8. Domain d5omua_: 5omu A: [354345]
    automated match to d3nc5a_
    complexed with 3dm, hem

Details for d5omua_

PDB Entry: 5omu (more details), 1.95 Å

PDB Description: crystal structure of amycolatopsis cytochrome p450 gcoa in complex with syringol
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5omua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5omua_ a.104.1.0 (A:) automated matches {Amycolatopsis sp. [TaxId: 385957]}
erpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcrevatspdfe
avitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarrylerfe
ndghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsftnaavdengefanpe
gfaegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiyptiyvyll
gamqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsataristkpv
tiagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacagiyfanh
vmrialeelfeaipnlerdtregvefwgwgfrgptslhvtwe

SCOPe Domain Coordinates for d5omua_ are not available.

Timeline for d5omua_: