Lineage for d5nzna_ (5nzn A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. Protein automated matches [190692] (20 species)
    not a true protein
  7. Species Unidentified influenza virus [TaxId:11309] [354282] (4 PDB entries)
  8. Domain d5nzna_: 5nzn A: [354341]
    automated match to d5huga_
    complexed with ca, edo, g39, nag; mutant

Details for d5nzna_

PDB Entry: 5nzn (more details), 1.7300000000000002 Å

PDB Description: complex of h275y/s247n mutant variant of neuraminidase from h1n1 influenza virus with oseltamivir
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d5nzna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nzna_ b.68.1.0 (A:) automated matches {Unidentified influenza virus [TaxId: 11309]}
svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg
kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
sisfcgvnsdtvgwswpdgaelpftid

SCOPe Domain Coordinates for d5nzna_ are not available.

Timeline for d5nzna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nznb_, d5nznc_, d5nznd_