Lineage for d1lxta3 (1lxt A:304-420)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127595Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
  4. 127596Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 127597Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 127612Protein Phosphoglucomutase [53740] (1 species)
  7. 127613Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 127640Domain d1lxta3: 1lxt A:304-420 [35434]
    Other proteins in same PDB: d1lxta4, d1lxtb4

Details for d1lxta3

PDB Entry: 1lxt (more details), 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit

SCOP Domain Sequences for d1lxta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxta3 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg

SCOP Domain Coordinates for d1lxta3:

Click to download the PDB-style file with coordinates for d1lxta3.
(The format of our PDB-style files is described here.)

Timeline for d1lxta3: