![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (1 protein) |
![]() | Protein Phosphoglucomutase, first 3 domains [53740] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
![]() | Domain d1lxta3: 1lxt A:304-420 [35434] Other proteins in same PDB: d1lxta4, d1lxtb4 |
PDB Entry: 1lxt (more details), 2.7 Å
SCOP Domain Sequences for d1lxta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxta3 c.84.1.1 (A:304-420) Phosphoglucomutase, first 3 domains {Rabbit (Oryctolagus cuniculus)} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
Timeline for d1lxta3:
![]() Domains from other chains: (mouse over for more information) d1lxtb1, d1lxtb2, d1lxtb3, d1lxtb4 |