Lineage for d5xv0d_ (5xv0 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511673Species Methanosarcina mazei [TaxId:192952] [354310] (4 PDB entries)
  8. 2511677Domain d5xv0d_: 5xv0 D: [354333]
    Other proteins in same PDB: d5xv0a2, d5xv0f2
    automated match to d2azna1
    complexed with nap; mutant

Details for d5xv0d_

PDB Entry: 5xv0 (more details), 1.95 Å

PDB Description: crystal structure of rib7 mutant d33n from methanosarcina mazei
PDB Compounds: (D:) conserved protein

SCOPe Domain Sequences for d5xv0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xv0d_ c.71.1.0 (D:) automated matches {Methanosarcina mazei [TaxId: 192952]}
drpfifinsamsadgklstkerkqvkisgklnfermdelrahadaimvgigtvladdpsl
tvksperkaarkaagksenpvrvvvdssartplnadifkkgeglriiavsnsapeekirm
leekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgnl
iiggktaptftdgegftenellglelssaekiedgillkwkvk

SCOPe Domain Coordinates for d5xv0d_:

Click to download the PDB-style file with coordinates for d5xv0d_.
(The format of our PDB-style files is described here.)

Timeline for d5xv0d_: