Lineage for d1lxta2 (1lxt A:191-303)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1876643Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 1876644Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 1876645Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 1876660Protein Phosphoglucomutase [53740] (1 species)
  7. 1876661Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 1876687Domain d1lxta2: 1lxt A:191-303 [35433]
    Other proteins in same PDB: d1lxta4, d1lxtb4
    complexed with cd, so4

Details for d1lxta2

PDB Entry: 1lxt (more details), 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit
PDB Compounds: (A:) phosphoglucomutase (dephospho form)

SCOPe Domain Sequences for d1lxta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxta2 c.84.1.1 (A:191-303) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOPe Domain Coordinates for d1lxta2:

Click to download the PDB-style file with coordinates for d1lxta2.
(The format of our PDB-style files is described here.)

Timeline for d1lxta2: